PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000235213
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 219aa    MW: 24343.9 Da    PI: 10.1572
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000235213genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM56.78.3e-18153200149
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49 
                    lppGfrFhPtdeel+++yL++kv++ +++  +++++vd++k+ePwdLp 
  MDP0000235213 153 LPPGFRFHPTDEELITHYLCHKVSDVSFTS-KAVADVDLNKCEPWDLPG 200
                    79*************************999.88**************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-18146202IPR003441NAC domain
PROSITE profilePS5100518.714153219IPR003441NAC domain
PfamPF023651.9E-7154189IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MQILQRSEEA VGQVLGLGLQ EGRKRRMLDQ VSKFALFSAA RKLLDVRHYF SSASGHQINF  60
HMSSLYFSNN VSTHGKVTIR QVLQIRHRHS RAKAIEQVSQ DFSGVLQGLI LLSLGHSSKD  120
KASQHQISVP GFLLASKSNP LGLFIESRMQ ESLPPGFRFH PTDEELITHY LCHKVSDVSF  180
TSKAVADVDL NKCEPWDLPG RKDSIGADLG LAKLARALS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-151522011463Stress-induced transcription factor NAC1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.13e-30NAC domain containing protein 58